- Recombinant Bacillus subtilis Uncharacterized lipoprotein ydiK (ydiK)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1148708
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,252 Da
- E Coli or Yeast
- 16-63
- Uncharacterized lipoprotein ydiK (ydiK)
Sequence
CIFTYLAASSPGSMWSFYSILLMVFAAYNISISFKMFAFSFKIKKNQK